General Information

  • ID:  hor002914
  • Uniprot ID:  P10776
  • Protein name:  Neuroparsin-B
  • Gene name:  NA
  • Organism:  Locusta migratoria (Migratory locust)
  • Family:  NA
  • Source:  animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Locusta (genus), Oedipodinae (subfamily), Acrididae (family), Acridoidea (superfamily), Acridomorpha, Acrididea (infraorder), Caelifera (suborder), Orthoptera (order), Polyneoptera (cohort), Neoptera (infraclass), Pterygota (subclass), Dicondylia, Insecta (class), Hexapoda (subphylum), Pancrustacea, Mandibulata, Arthropoda (phylum), Panarthropoda, Ecdysozoa, Protostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005179 hormone activity
  • GO BP:  GO:0007218 neuropeptide signaling pathway
  • GO CC:  NA

Sequence Information

  • Sequence:  SCEGANCVVDLTRCEYGDVTDFFGRKVCAKGPGDKCGGPYELHGKCGVGMDCRCGLCSGCSLHNLQCFFFEGGLPSSC
  • Length:  78(30-107)
  • Propeptide:  MKATAALVAATLLLAVTLFHRAERNPISRSCEGANCVVDLTRCEYGDVTDFFGRKVCAKGPGDKCGGPYELHGKCGVGMDCRCGLCSGCSLHNLQCFFFEGGLPSSC
  • Signal peptide:  MKATAALVAATLLLAVTLFHRA
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  inhibit the effects of juvenile hormone, stimulate fluid reabsorption of isolated recta and induces an increase in hemolymph lipid and trehalose levels
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-P10776-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor002914_AF2.pdbhor002914_ESM.pdb

Physical Information

Mass: 957101 Formula: C344H528N98O109S13
Absent amino acids: IW Common amino acids: G
pI: 5.59 Basic residues: 9
Polar residues: 37 Hydrophobic residues: 18
Hydrophobicity: -3.33 Boman Index: -8925
Half-Life: 1.9 hour Half-Life Yeast: >20 hour
Half-Life E.Coli: >10 hour Aliphatic Index 51.15
Instability Index: 1981.79 Extinction Coefficient cystines: 3730
Absorbance 280nm: 48.44

Literature

  • PubMed ID:  2924926
  • Title:  Amino acid sequence of locust neuroparsins